PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g17370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 119aa    MW: 14048.1 Da    PI: 9.8501
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g17370genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox36.67.6e-124322856
                HHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox 28 eereeLAkklgLterqVkvWFqNrRakek 56
                +++  LAk+l+L +rqV vWFqNrRa+ k
  CA01g17370  4 KQKLALAKQLNLRQRQVEVWFQNRRARTK 32
                67889**********************98 PP

2HD-ZIP_I/II90.91.4e-293682692
  HD-ZIP_I/II 26 perKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92
                 +++K +la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
   CA01g17370  3 QKQKLALAKQLNLRQRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-ALK 68
                 689***********************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007112.989134IPR001356Homeobox domain
CDDcd000861.39E-6335No hitNo description
PfamPF000462.6E-9432IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-10437IPR009057Homeodomain-like
SuperFamilySSF466891.8E-10443IPR009057Homeodomain-like
PROSITE patternPS000270932IPR017970Homeobox, conserved site
PfamPF021839.4E-123468IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.1E-263477IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MVQKQKLALA KQLNLRQRQV EVWFQNRRAR TKLKQTEVDC EYLKRCCETL TEENRRLHKE  60
LQELRALKTS NPFYMQLPAT TLTMCPSCER VASTTTSAPX XXXXXXXNHH YHHHYQSP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12634RRARTKLKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754402e-69HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016537388.12e-63PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotQ6YPD06e-56HOX27_ORYSJ; Homeobox-leucine zipper protein HOX27
TrEMBLA0A068URD43e-58A0A068URD4_COFCA; Uncharacterized protein
TrEMBLA0A0D2Q9Z57e-59A0A0D2Q9Z5_G
STRINGGLYMA15G42380.15e-57(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-45homeobox from Arabidopsis thaliana